Primary Antibodies

View as table Download

Rabbit Polyclonal anti-RARB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RARB antibody is: synthetic peptide directed towards the N-terminal region of Human RARB. Synthetic peptide located within the following region: EKALKACFSGLTQTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPRVYK

Rabbit Polyclonal Anti-RXRB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRB antibody: synthetic peptide directed towards the N terminal of human RXRB. Synthetic peptide located within the following region: GDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPP

Rabbit Polyclonal Anti-RXRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRB antibody: synthetic peptide directed towards the N terminal of human RXRB. Synthetic peptide located within the following region: PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA

Rabbit Polyclonal Anti-RXRG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRG antibody: synthetic peptide directed towards the N terminal of human RXRG. Synthetic peptide located within the following region: NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRA antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRA antibody: synthetic peptide directed towards the C terminal of human RXRA. Synthetic peptide located within the following region: MDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQ

Rabbit Polyclonal Anti-RXRG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRG antibody: synthetic peptide directed towards the N terminal of human RXRG. Synthetic peptide located within the following region: GSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLP

Rabbit Polyclonal Anti-RXRG Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRG antibody: synthetic peptide directed towards the C terminal of human RXRG. Synthetic peptide located within the following region: LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT

Rabbit Polyclonal Anti-RXRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRB antibody: synthetic peptide directed towards the C terminal of human RXRB. Synthetic peptide located within the following region: AKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIG

Rabbit Polyclonal Anti-Retinoic Acid Receptor beta Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Retinoic Acid Receptor beta Antibody: A synthesized peptide derived from human Retinoic Acid Receptor beta