Rabbit polyclonal NR1D2 Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NR1D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 266-294 amino acids from the Central region of human NR1D2. |
Rabbit Polyclonal Anti-NR1D2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1D2 antibody: synthetic peptide directed towards the C terminal of human NR1D2. Synthetic peptide located within the following region: ETLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP |
Rabbit Polyclonal Anti-NR1D2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1D2 antibody: synthetic peptide directed towards the middle region of human NR1D2. Synthetic peptide located within the following region: MSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFT |
Rabbit Polyclonal Anti-NR1D2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1D2 antibody: synthetic peptide directed towards the N terminal of human NR1D2. Synthetic peptide located within the following region: YISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDL |
Germany
Japan
United Kingdom
China
