Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-KCNH6 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KCNH6

Rabbit Polyclonal Anti-KV11.2 (erg2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide TLNFVEFNLEKHRS(C), corresponding to amino acid residues 185-198 of human Kv11.2. Intracellular, N-terminal part.

Rabbit Polyclonal Anti-KCNH6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNH6 antibody: synthetic peptide directed towards the N terminal of human KCNH6. Synthetic peptide located within the following region: GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK

Rabbit Polyclonal Anti-KCNH6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNH6 antibody: synthetic peptide directed towards the middle region of human KCNH6. Synthetic peptide located within the following region: LSTLYFISRGSIEILRDDVVVAILGKNDIFGEPVSLHAQPGKSSADVRAL

Rabbit Polyclonal Anti-KCNH6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNH6 antibody: synthetic peptide directed towards the middle region of human KCNH6. Synthetic peptide located within the following region: PRMPHLAVATDKTLAPSSEQEQPEGLWPPLASPLHPLEVQGLICGPCFSS

Rabbit Polyclonal Anti-KCNH6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNH6 antibody: synthetic peptide directed towards the middle region of human KCNH6. Synthetic peptide located within the following region: PLASPLHPLEVQGLICGPCFSSLPEHLGSVPKQLDFQRHGSDPGFAGSWG