Primary Antibodies

Jump to Filters
View as table Download
CLIC4 Rabbit Polyclonal Antibody
TA326231

USD 380.00

In Stock

Rabbit polyclonal CLIC4 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human CLIC4.
CLIC4 Rabbit Polyclonal Antibody
TA302056

USD 580.00

2 Weeks

Rabbit Polyclonal Antibody against CLIC4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CLIC4 antibody is generated from rabbits immunized with recombinant human CLIC4 protein.
CLIC4 Rabbit Polyclonal Antibody
TA328642

USD 850.00

3 Weeks

Rabbit Polyclonal Anti-CLIC4

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)NGLKEEDKEPLIE, corresponding to amino acid residues 8 - 20 of human CLIC4. Intracellular, N-terminus.
CLIC4 Rabbit Polyclonal Antibody
TA351085

USD 380.00

In Stock

Rabbit Polyclonal Anti-CLIC4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLIC4
CLIC4 Goat Polyclonal Antibody
TA302454

USD 520.00

5 Days

Goat Polyclonal Antibody against CLIC4

Applications WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence NGLKEEDKEPLIE-C, from the N Terminus of the protein sequence according to NP_039234.1.
CLIC4 Rabbit Polyclonal Antibody
TA338569

USD 485.00

5 Days

Rabbit Polyclonal Anti-CLIC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLIC4 antibody: synthetic peptide directed towards the N terminal of human CLIC4. Synthetic peptide located within the following region: LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF