Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CACNB2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CACNB2

Rabbit Polyclonal Anti-Cacnb2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Cacnb2 antibody is: synthetic peptide directed towards the middle region of Rat Cacnb2. Synthetic peptide located within the following region: DFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQ