USD 447.00
In Stock
GABRA5 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
GABRA5 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) GABRA5 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
GABRA5 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
GABRA5 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-GABRA5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW |
USD 447.00
In Stock
GABRA5 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) GABRA5 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
GABRA5 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
GABRA5 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 447.00
In Stock
GABRA5 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) GABRA5 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
GABRA5 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
GABRA5 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 447.00
In Stock
GABRA5 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) GABRA5 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |