NPBWR2 / GPR8 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | NPBWR2 / GPR8 antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human NPBWR2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (94%); Gibbon (88%). |
Rabbit Polyclonal Anti-NPBWR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPBWR2 antibody is: synthetic peptide directed towards the N-terminal region of Human NPBWR2. Synthetic peptide located within the following region: LPTMGANVSQDNGTGHNATFSEPLPFLYVLLPAVYSGICAVGLTGNTAVI |
NPBWR2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NPBWR2 |
Germany
Japan
United Kingdom
China
