Rabbit polyclonal anti-SPR1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SPR1. |
Rabbit polyclonal anti-SPR1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SPR1. |
Rabbit Polyclonal Anti-GPR68 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPR68 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR68. Synthetic peptide located within the following region: GILRAVRRSHGTQKSRKDQIQRLVLSTVVIFLACFLPYHVLLLVRSVWEA |
Rabbit Polyclonal Anti-SPR1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SPR1 Antibody: A synthesized peptide derived from human SPR1 |