Primary Antibodies

Jump to Filters
View as table Download
EDG2 (LPAR1) Mouse Monoclonal Antibody [Clone ID: OTI1G6]
TA503737

USD 478.00

In Stock

LPAR1 (EDG2) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
EDG2 (LPAR1) Mouse Monoclonal Antibody [Clone ID: OTI1G6]
CF503737

USD 600.00

3 Weeks

Carrier-free (BSA/glycerol-free) LPAR1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA341637

USD 539.00

5 Days

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
Metabotropic Glutamate Receptor 1 (GRM1) Rabbit Polyclonal Antibody
TA321217

USD 380.00

4 Weeks

Anti-GRM1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 31-44 amino acids of Human glutamate receptor, metabotropic 1
5 HT 2A (HTR2A) Rabbit Polyclonal Antibody
RA24288-100

USD 805.00

2 Weeks

5 HT 2A (HTR2A) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Metabotropic Glutamate Receptor 1 (GRM1) Rabbit Polyclonal Antibody
TA321218

USD 380.00

In Stock

Anti-GRM1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 31-44 amino acids of Human glutamate receptor, metabotropic 1
EDG2 (LPAR1) Mouse Monoclonal Antibody [Clone ID: OTI1G6]
TA503737S

USD 200.00

In Stock

LPAR1 (EDG2) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
5 HT 2A (HTR2A) Rabbit Polyclonal Antibody
24288

USD 690.00

3 Days

5 HT 2A (HTR2A) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Multiple antigenic peptide (MAP) of an N-terminal synthetic sequence corresponding to amino acids (22–41) of rat 5HT2A receptor.
EDG2 (LPAR1) Rabbit Polyclonal Antibody
TA350844

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-LPAR1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human LPAR1
HTR2C Rabbit Polyclonal Antibody
TA313299

USD 380.00

In Stock

Rabbit polyclonal anti-5-HT-2C antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-2C.
HTR2C Rabbit Polyclonal Antibody
AP01291PU-N

USD 465.00

3 Weeks

HTR2C rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 400-450 of Human SR-2C.
Dopamine D2 Receptor (DRD2) (C-term) Rabbit Polyclonal Antibody
AP51318PU-N

USD 580.00

2 Weeks

Dopamine D2 Receptor (DRD2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 306-336 amino acids from the C-terminal region of Human Dopamine D2 receptor.
HTR2C Rabbit Polyclonal Antibody
24505

USD 660.00

3 Days

HTR2C rabbit polyclonal antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated