Rabbit Polyclonal Anti-OR13C5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR13C5 Antibody: synthetic peptide directed towards the N terminal of human OR13C5. Synthetic peptide located within the following region: ICYTTTSIPSTLVSFLSERKTISLSGCAVQMFLSLAMGTTECVLLGVMAF |
Rabbit Polyclonal Anti-OR2A42 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR2A42 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2A42. Synthetic peptide located within the following region: FGSAIIMYMAPKSRHPEEQQKVFFLFYSFFNPTLNPLIYSLRNGEVKGAL |
Rabbit Polyclonal Anti-OR2C1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2C1 antibody: synthetic peptide directed towards the C terminal of human OR2C1. Synthetic peptide located within the following region: FYGSASYGYLLPAKNSKQDQGKFISLFYSLVTPMVNPLIYTLRNMEVKGA |
Rabbit Polyclonal Anti-OR2D3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2D3 antibody: synthetic peptide directed towards the C terminal of human OR2D3. Synthetic peptide located within the following region: LKAFSTCGSHLIVVVLFYGSGIFTYMRPNSKTTKELDKMISVFYTAVTPM |
Germany
Japan
United Kingdom
China