Primary Antibodies

View as table Download

Rabbit Polyclonal S1P5/EDG-8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 15-55 of human Edg8 was used as the immunogen, GenBank no NP_110387.

Rabbit Polyclonal anti-EDG8 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDG8 antibody: synthetic peptide directed towards the N terminal of human EDG8. Synthetic peptide located within the following region: MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI