Rabbit Polyclonal Anti-CMKLR1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CMKLR1 |
Rabbit Polyclonal Anti-CMKLR1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CMKLR1 |
Rabbit polyclonal anti-CMKLR1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CMKLR1. |
Rabbit Polyclonal Anti-CMKLR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CMKLR1 antibody: synthetic peptide directed towards the C terminal of human CMKLR1. Synthetic peptide located within the following region: KKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETGML |