Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-BDNF Antibody

Applications IHC, WB
Reactivities Mouse, Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG

Rabbit Polyclonal Anti-KCNN2 Antibody

Applications IHC, WB
Reactivities Human, Rat, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the C terminal of human KCNN2. Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM

Rabbit Polyclonal Anti-KCNN2 Antibody

Applications WB
Reactivities Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the middle region of human KCNN2. Synthetic peptide located within the following region: KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ

Rabbit polyclonal STAT2 phospho Y690 antibody

Applications IHC, WB
Reactivities Human, Chimpanzee, Macaque, Monkey, Rat, Dog, Pig, Mouse, Bovine, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of human STAT2 protein.

Rabbit Polyclonal Anti-TAAR6 Antibody

Applications IHC, WB
Reactivities Mouse, Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-TAAR6 antibody is: synthetic peptide directed towards the C-terminal region of Human TAAR6. Synthetic peptide located within the following region: YGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVA

Rabbit Polyclonal Anti-KCNN3 Antibody

Applications IHC, WB
Reactivities Mouse, Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNN3 antibody: synthetic peptide directed towards the C terminal of human KCNN3. Synthetic peptide located within the following region: ITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSA

Rabbit Polyclonal Anti-SPSB2 Antibody

Applications IHC, WB
Reactivities Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-SPSB2 antibody: synthetic peptide directed towards the N terminal of human SPSB2. Synthetic peptide located within the following region: KDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQR

Rabbit Polyclonal Anti-SPSB2 Antibody

Applications IHC, WB
Reactivities Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-SPSB2 antibody: synthetic peptide directed towards the C terminal of human SPSB2. Synthetic peptide located within the following region: IGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGG

Rabbit Polyclonal Anti-ATP2A1 Antibody

Applications IHC, WB
Reactivities Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP2A1 antibody: synthetic peptide directed towards the N terminal of human ATP2A1. Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW

Rabbit polyclonal PPAR Gamma 2 antibody

Applications WB
Reactivities Human, Macaque
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the amino terminus of human PPAR gamma 2.

Rabbit polyclonal anti-Wnt1 antibody

Applications WB
Reactivities Mouse, Human, Bovine, Dog, Macaque, Rat, Opossum
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Wnt1 protein.

Rabbit polyclonal anti-NEDD4 antibody

Applications WB
Reactivities Human, Macaque, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of the Nedd4 protein.

Mouse monoclonal anti-LGR4 antibody

Applications IHC
Reactivities Human, Chimpanzee, Macaque
Conjugation Unconjugated

Mouse Monoclonal Anti-IFN-gamma Antibody, Biotin conjugated

Reactivities Human, Macaque
Conjugation Biotin