USD 478.00
In Stock
SMPD1 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 478.00
In Stock
SMPD1 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) SMPD1 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
SMPD1 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
SMPD1 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
USD 200.00
In Stock
SMPD1 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 224.00
USD 447.00
In Stock
SMPD1 mouse monoclonal antibody, clone OTI10C5 (formerly 10C5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) SMPD1 mouse monoclonal antibody, clone OTI10C5 (formerly 10C5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
SMPD1 mouse monoclonal antibody, clone OTI10C5 (formerly 10C5), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
SMPD1 mouse monoclonal antibody, clone OTI10C5 (formerly 10C5), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal Anti-SMPD1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMPD1 antibody: synthetic peptide directed towards the middle region of human SMPD1. Synthetic peptide located within the following region: INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV |
SMPD1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SMPD1 |
USD 200.00
2 Days
SMPD1 mouse monoclonal antibody, clone OTI10C5 (formerly 10C5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |