Primary Antibodies

View as table Download

SMPD1 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SMPD1 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

SMPD1 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

SMPD1 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

SMPD1 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SMPD1 mouse monoclonal antibody, clone OTI10C5 (formerly 10C5)

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-SMPD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMPD1 antibody: synthetic peptide directed towards the middle region of human SMPD1. Synthetic peptide located within the following region: INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV

SMPD1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SMPD1