BECN1 (Beclin 1) mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Mouse |
Conjugation | Unconjugated |
BECN1 (Beclin 1) mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BECN1 mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Mouse |
Conjugation | Unconjugated |
USD 224.00
USD 447.00
In Stock
BECN1 (Beclin 1) mouse monoclonal antibody, clone OTI3C3 (formerly 3C3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
BECN1 (Beclin 1) mouse monoclonal antibody, clone OTI1F1 (formerly 1F1), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Mouse |
Conjugation | Biotin |
USD 509.00
2 Weeks
BECN1 (Beclin 1) mouse monoclonal antibody, clone OTI1F1 (formerly 1F1), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Mouse |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) BECN1 mouse monoclonal antibody, clone OTI3C3 (formerly 3C3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
BECN1 (Beclin 1) mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Mouse |
Conjugation | Unconjugated |
USD 509.00
5 Days
BECN1 mouse monoclonal antibody, clone 3C3, Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Biotin |
USD 509.00
5 Days
BECN1 mouse monoclonal antibody, clone 3C3, HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | HRP |
BECN1 (Beclin 1) mouse monoclonal antibody, clone OTI3C3 (formerly 3C3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Goat Anti-PRKAA2 Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CPLDALNTTKP, from the internal region of the protein sequence according to NP_006243.2. |
Rabbit Polyclonal Anti-GABARAP
Applications | WB |
Reactivities | Human, Insect, Cow, Dog, Mouse, Pig, Rabbit, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
Goat Polyclonal Antibody against ULK3 (aa445-458)
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Pig, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KMRESRWEADTLDK, from the C Terminus of the protein sequence according to NP_001092906.1. |
Rabbit anti AMPK-alpha(pT172) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat, Mouse, Bovine, Chicken, Dog, Invertebrate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding to the epitope -LRTSC- with a phosphorylation site at Thr 172 of AMPK alpha protein from human origin |
Rabbit anti AMPK-alpha Polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat, Mouse, Bovine, Chicken, Dog, Invertebrate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding to the epitope -LRTSC- with a phosphorylation site at Thr 172 of AMPK alpha protein from human origin |