Rabbit polyclonal anti-POLR2C antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This POLR2C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 200-228 amino acids from the C-terminal region of human POLR2C. |
Rabbit anti-POLR2C Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human POLR2C |
Rabbit Polyclonal Anti-POLR1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-POLR1C antibody is: synthetic peptide directed towards the N-terminal region of Human POLR1C. Synthetic peptide located within the following region: VRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDA |
Rabbit Polyclonal Anti-POLR2C Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Polr2c antibody is: synthetic peptide directed towards the C-terminal region of Mouse Polr2c. Synthetic peptide located within the following region: YDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERLGDLGPR |
POLR1C Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human POLR1C |
POLR1C Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human POLR1C |
POLR1C Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human POLR1C |
Germany
Japan
United Kingdom
China