Rabbit Polyclonal Anti-LDHB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LDHB antibody is: synthetic peptide directed towards the C-terminal region of Human LDHB. Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD |
LDHB mouse monoclonal antibody, clone AT14D7, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
LDHB mouse monoclonal antibody, clone AT14D7, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
LDHB Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | internal region (near N terminus) (EEATVPNNKIT) |
Germany
Japan
United Kingdom
China
