Primary Antibodies

View as table Download

ETV7 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)

Applications WB
Reactivities Human
Conjugation Unconjugated

ETV7 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ETV7 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ETV7 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)

Applications WB
Reactivities Human
Conjugation Unconjugated

ETV7 mouse monoclonal antibody,clone 3B2, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

ETV7 mouse monoclonal antibody,clone 2A10, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

Rabbit Polyclonal Anti-ETV7 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ETV7

ETV7 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-ETV7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ETV7 Antibody: synthetic peptide directed towards the N terminal of human ETV7. Synthetic peptide located within the following region: SLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRAL

Rabbit Polyclonal Anti-ETV7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ETV7 antibody: synthetic peptide directed towards the C terminal of human ETV7. Synthetic peptide located within the following region: IIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEIS

ETV7 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)

Applications WB
Reactivities Human
Conjugation Unconjugated