Primary Antibodies

Jump to Filters
View as table Download
Rab5 (RAB5A) Goat Polyclonal Antibody
AB0009-200

USD 355.00

In Stock

Goat Polyclonal Anti-Rab5a Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab5a produced in E. coli.
EGFR Rabbit Polyclonal Antibody
TA312545

USD 380.00

4 Weeks

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).
Rab5 (RAB5A) Goat Polyclonal Antibody
AB1024-200

USD 330.00

In Stock

Goat Polyclonal Anti-Rab5 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab5a, Rab5b and rab5c produced in E. coli.
beta 2 Adrenergic Receptor (ADRB2) Rabbit Polyclonal Antibody
TA323758

USD 380.00

2 Weeks

Anti-ADRB2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 21-33 amino acids of Human adrenoceptor beta 2, surface
RAB11A Goat Polyclonal Antibody
AB0034-200

USD 355.00

In Stock

Goat Polyclonal Anti-Rab11a Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Rat, Mouse
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 110 aa to the C-terminus of mouse Rab11a produced in E. coli.
Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
TA321416

USD 380.00

4 Weeks

Anti-F2R Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor
FGFR4 Rabbit Polyclonal Antibody
TA324961

USD 580.00

2 Weeks

Rabbit polyclonal FGFR4 Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FGFR4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-55 amino acids from the N-terminal region of human FGFR4.
VEGF Receptor 2 (KDR) Rabbit Polyclonal Antibody
TA309974

USD 565.00

2 Weeks

Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G).
Modifications Phospho-specific
VEGF Receptor 2 (KDR) Rabbit Polyclonal Antibody
TA325608

USD 380.00

4 Weeks

Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214
Modifications Phospho-specific
SRC Rabbit Polyclonal Antibody
TA322607

USD 380.00

In Stock

Anti-SRC Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 270-523 amino acids of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian)
CD71 (TFRC) Rabbit Polyclonal Antibody
TA324761

USD 580.00

2 Weeks

Rabbit polyclonal CD71 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD71 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 649-677 amino acids from the C-terminal region of human CD71.
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA341637

USD 539.00

5 Days

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
TSG101 Rabbit Polyclonal Antibody
TA343598

USD 485.00

5 Days

Rabbit Polyclonal Anti-TSG101 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TSG101 antibody: synthetic peptide directed towards the C terminal of human TSG101. Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY
Rab11 (RAB11B) Goat Polyclonal Antibody
AB0082-200

USD 355.00

In Stock

Goat Polyclonal Anti-Rab11b Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Rat, Mouse
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab11b produced in E. coli.
MCSF Receptor (CSF1R) Rabbit Polyclonal Antibody
TA312195

USD 380.00

In Stock

Rabbit polyclonal CSFR (Ab-809) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human CSFR around the phosphorylation site of tyrosine 809 (S-N-YP-I-V).