HSPA1L mouse monoclonal antibody,clone OTI2H3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HSPA1L mouse monoclonal antibody,clone OTI2H3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HSPA1L mouse monoclonal antibody,clone OTI1F12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HSPA1L mouse monoclonal antibody,clone OTI3B10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HSPA1L mouse monoclonal antibody,clone OTI3B5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HSPA1L mouse monoclonal antibody,clone OTI1G8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPA1L mouse monoclonal antibody,clone OTI1F12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPA1L mouse monoclonal antibody,clone OTI2H3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPA1L mouse monoclonal antibody,clone OTI3B10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPA1L mouse monoclonal antibody,clone OTI3B5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPA1L mouse monoclonal antibody,clone OTI1G8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HSPA1L Antibody
Applications | WB |
Reactivities | Human, Rat, Lamprey |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HSPA1L Antibody: synthetic peptide directed towards the C terminal of human HSPA1L. Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD |
HSPA1L Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSPA1L |
HSPA1L Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse HSPA1L |
HSPA1L mouse monoclonal antibody,clone OTI1F12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HSPA1L mouse monoclonal antibody,clone OTI2H3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |