Primary Antibodies

View as table Download

COQ6 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 61-91 amino acids from the N-terminal region of human COQ6

Rabbit Polyclonal Anti-COQ6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COQ6 antibody is: synthetic peptide directed towards the N-terminal region of Human COQ6. Synthetic peptide located within the following region: ILLLEAGPKKVLEKLSETYSNRVSSISPGSATLLSSFGAWDHICNMRYRA

COQ6 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated