Rabbit Polyclonal Anti-PRPF4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPF4 antibody: synthetic peptide directed towards the N terminal of human PRPF4. Synthetic peptide located within the following region: EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPIT |
PRPF4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PRPF4 |
PRPF4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PRPF4 |
Germany
Japan
United Kingdom
China