Primary Antibodies

View as table Download

PPIH mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPIH mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPIH mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPIH mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPIH mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPIH mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-PPIH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPIH antibody: synthetic peptide directed towards the N terminal of human PPIH. Synthetic peptide located within the following region: VVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDG

Rabbit Polyclonal Anti-PPIH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPIH antibody: synthetic peptide directed towards the middle region of human PPIH. Synthetic peptide located within the following region: DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN