Primary Antibodies

Jump to Filters
View as table Download
RNF41 Mouse Monoclonal Antibody [Clone ID: OTI2C1]
TA811158

USD 447.00

In Stock

RNF41 mouse monoclonal antibody,clone OTI2C1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RNF41 Mouse Monoclonal Antibody [Clone ID: OTI2C1]
CF811158

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) RNF41 mouse monoclonal antibody,clone OTI2C1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RNF41 Mouse Monoclonal Antibody [Clone ID: OTI2C1]
TA811158S

USD 200.00

In Stock

RNF41 mouse monoclonal antibody,clone OTI2C1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RNF41 Rabbit Polyclonal Antibody
TA337293

USD 539.00

5 Days

Rabbit Polyclonal Anti-RNF41 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF41 antibody: synthetic peptide directed towards the middle region of human RNF41. Synthetic peptide located within the following region: QQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETI