ARFGAP1 mouse monoclonal antibody, clone OTI 2C10 (formerly 2C10)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ARFGAP1 mouse monoclonal antibody, clone OTI 2C10 (formerly 2C10)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARFGAP1 mouse monoclonal antibody, clone OTI 2C10 (formerly 2C10)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ARFGAP1 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ARFGAP1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
ARFGAP1 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
ARFGAP1 mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
ARFGAP1 mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ARFGAP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ARFGAP1 |
ARFGAP1 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
ARFGAP1 mouse monoclonal antibody, clone OTI 2C10 (formerly 2C10)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ARFGAP1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARFGAP1 antibody: synthetic peptide directed towards the middle region of human ARFGAP1. Synthetic peptide located within the following region: WRDVTTFFSGKAEGPLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAE |
Rabbit Polyclonal Anti-ARFGAP1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARFGAP1 antibody: synthetic peptide directed towards the middle region of human ARFGAP1. Synthetic peptide located within the following region: GQPQSVTASSDKAFEDWLNDDLGSYQGAQGNRYVGFGNTPPPQKKEDDFL |