Primary Antibodies

View as table Download

ARFGAP1 mouse monoclonal antibody, clone OTI 2C10 (formerly 2C10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARFGAP1 mouse monoclonal antibody, clone OTI 2C10 (formerly 2C10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ARFGAP1 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ARFGAP1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

ARFGAP1 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

ARFGAP1 mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

ARFGAP1 mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ARFGAP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ARFGAP1

ARFGAP1 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

ARFGAP1 mouse monoclonal antibody, clone OTI 2C10 (formerly 2C10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ARFGAP1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARFGAP1 antibody: synthetic peptide directed towards the middle region of human ARFGAP1. Synthetic peptide located within the following region: WRDVTTFFSGKAEGPLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAE

Rabbit Polyclonal Anti-ARFGAP1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARFGAP1 antibody: synthetic peptide directed towards the middle region of human ARFGAP1. Synthetic peptide located within the following region: GQPQSVTASSDKAFEDWLNDDLGSYQGAQGNRYVGFGNTPPPQKKEDDFL