Primary Antibodies

Jump to Filters
View as table Download
PAX6 Rabbit Polyclonal Antibody
TA379655

USD 365.00

3 Weeks

PAX6 Rabbit polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human PAX6 (NP_000271.1).
Modifications Unmodified
PAX6 Rabbit Polyclonal Antibody
TA335202

USD 539.00

5 Days

Rabbit Polyclonal Anti-PAX6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX6 antibody: synthetic peptide directed towards the N terminal of human PAX6. Synthetic peptide located within the following region: LAHSGARPCDISRILQTHADAKVQVLDNQNVSNGCVSKILGRYYETGSIR
Pax6 Goat Polyclonal Antibody
TA303232

USD 520.00

5 Days

Goat Polyclonal Antibody against PAX6

Applications WB
Reactivities Mouse (Expected from sequence similarity: Human, Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence C-REEKLRNQRRQASN, from the internal region of the protein sequence according to NP_000271.1; NP_001595.2.
PAX6 Rabbit Polyclonal Antibody
TA331135

USD 539.00

5 Days

Rabbit Polyclonal Anti-PAX6 Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX6 antibody: synthetic peptide directed towards the N terminal of human PAX6. Synthetic peptide located within the following region: GRPLPDSTRQKIVELAHSGARPCDISRILQTHADAKVQVLDNQNVSNGCV