Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-DHX15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHX15 antibody: synthetic peptide directed towards the N terminal of human DHX15. Synthetic peptide located within the following region: GHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSF

Rabbit Polyclonal Anti-DHX15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHX15 antibody: synthetic peptide directed towards the C terminal of human DHX15. Synthetic peptide located within the following region: YINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVL