COPS6 mouse monoclonal antibody, clone OTI4E7 (formerly 4E7)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
COPS6 mouse monoclonal antibody, clone OTI4E7 (formerly 4E7)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) COPS6 mouse monoclonal antibody, clone OTI4E7 (formerly 4E7)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
COPS6 mouse monoclonal antibody,clone OTI2F5
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) COPS6 mouse monoclonal antibody,clone OTI2F5
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
COPS6 mouse monoclonal antibody,clone OTI2H4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) COPS6 mouse monoclonal antibody,clone OTI2H4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
COPS6 mouse monoclonal antibody, clone OTI4E7 (formerly 4E7)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-COPS6 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COPS6 antibody: synthetic peptide directed towards the middle region of human COPS6. Synthetic peptide located within the following region: DHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEV |
COPS6 mouse monoclonal antibody,clone OTI2F5
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
COPS6 mouse monoclonal antibody,clone OTI2H4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |