Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to STIP1 (stress-induced-phosphoprotein 1)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 300 of STIP1 (Uniprot ID#P31948)

Rabbit polyclonal STIP1 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine, Hamster)
Conjugation Unconjugated
Immunogen This STIP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 269-297 amino acids from the Central region of human STIP1.

Prion protein PrP (PRNP) mouse monoclonal antibody, clone EM-20, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal STIP1 Antibody (C-term)

Applications FC, WB
Reactivities Human, Mouse (Predicted: Rat, Bovine, Hamster, Monkey)
Conjugation Unconjugated
Immunogen This STIP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 461-488 amino acids from the C-terminal region of human STIP1.

Rabbit Polyclonal Anti-STIP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STIP1 antibody: synthetic peptide directed towards the C terminal of human STIP1. Synthetic peptide located within the following region: YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS

Rabbit Polyclonal Prion protein Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Goat Polyclonal Antibody against Prion Protein (143-153)

Applications WB
Reactivities Human (Expected from sequence similarity: Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-SDYEDRYYREN, from the internal region of the protein sequence according to NP_000302.1; NP_898902.1.

Rabbit Polyclonal Anti-STIP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STIP1 antibody: synthetic peptide directed towards the N terminal of human STIP1. Synthetic peptide located within the following region: ALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNM

Rabbit Polyclonal Anti-PRNP Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Prnp antibody is: synthetic peptide directed towards the middle region of Mouse Prnp. Synthetic peptide located within the following region: GGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHF