Rabbit Polyclonal Anti-RIPK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RIPK1 antibody: synthetic peptide directed towards the middle region of human RIPK1. Synthetic peptide located within the following region: RRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQ |
Rabbit Polyclonal RIP1 Antibody
| Applications | E, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | RIP1 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human RIP1. |
RIPK1 (RIP) mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
