Primary Antibodies

Jump to Filters
View as table Download
KCNV2 (C-term) Rabbit Polyclonal Antibody
AP52321PU-N

USD 580.00

2 Weeks

KCNV2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 477-507 amino acids from the C-terminal region of human KCNV2
KCNV2 Rabbit Polyclonal Antibody
TA316201

USD 380.00

4 Weeks

Rabbit polyclonal anti-OR4K3 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR4K3.
KCNV2 Rabbit Polyclonal Antibody
TA338726

USD 539.00

5 Days

Rabbit Polyclonal Anti-KCNV2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNV2 antibody: synthetic peptide directed towards the N terminal of human KCNV2. Synthetic peptide located within the following region: RSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAK
KCNV2 Rabbit Polyclonal Antibody
TA361444

USD 539.00

5 Days

KCNV2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KCNV2