Primary Antibodies

View as table Download

Rabbit Polyclonal KCNK12 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KCNK12 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of human KCNK12.

Rabbit polyclonal anti-KCNK12 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human KCNK12.

Rabbit Polyclonal Anti-KCNK12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNK12 antibody: synthetic peptide directed towards the middle region of human KCNK12. Synthetic peptide located within the following region: EGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGF