Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-CHRNA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the C terminal of human CHRNA1. Synthetic peptide located within the following region: STHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISG |
Rabbit anti-CHRNA1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRNA1 |
Rabbit Polyclonal Anti-CHRNA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the N terminal of human CHRNA1. Synthetic peptide located within the following region: TRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNV |
Rabbit Polyclonal Anti-CHRNA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the N terminal of human CHRNA1. Synthetic peptide located within the following region: AGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVD |
Active filters
Target Symbol
- CHRNA1
Conjugates
- Unconjugated
Families
- Ion Channels: Cys-loop Receptors