Primary Antibodies

View as table Download

Rabbit Polyclonal anti-GLI2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE

Rabbit Polyclonal Anti-BMP6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human BMP6

Rabbit Polyclonal Anti-CDX2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CDX2

Anti-TAT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 250 amino acids of human tyrosine aminotransferase

Rabbit Polyclonal Anti-BDNF Antibody

Applications IHC, WB
Reactivities Mouse, Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG

Rabbit Polyclonal Anti-SMAD3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SMAD3

Rabbit Polyclonal Anti-PAX7 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the N terminal of human PAX7. Synthetic peptide located within the following region: KEEEDEADKKEDDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRK

Anti-HNF1B Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 36-50 amino acids of human HNF1 homeobox B

Anti-FGF4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 192-206 amino acids of Human fibroblast growth factor 4

Anti-BDNF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 153-168 amino acids of Human brain-derived neurotrophic factor

Rabbit Polyclonal Anti-GRB7 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GRB7

Rabbit Polyclonal Anti-KIT Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KIT

Rabbit Polyclonal NANOG Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NANOG antibody was raised against a 19 amino acid peptide near the center of human NANOG.

Rabbit polyclonal SOX-9 (Ser181) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human SOX-9 around the phosphorylation site of serine 181 (R-K-SP-V-K).
Modifications Phospho-specific

Anti-SOX2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human SRY (sex determining region Y)-box 2