Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
FRG1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 230-256 amino acids from the C-terminal region of Human FRG1 |
Goat Anti-FRG1 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TVTNFGEISGT, from the internal region of the protein sequence according to NP_004468.1. |
Rabbit Polyclonal Anti-Frg1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Frg1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GINSDGLVVGRSDAIGPREQWEPVFQDGKMALLASNSCFIRCNEAGDIEA |
FRG1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human FRG1 |
FRG1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FRG1 |
Active filters
Target Symbol
- FRG1
Clonalities
- Polyclonal