Germany
Japan
United Kingdom
China
Histamine rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Insect, Rat |
| Conjugation | Unconjugated |
Primary Antibodies
View as table Download
FH (176-189) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Human, Mouse, Rat, Bovine, Chicken, Drosophila, Equine, Hamster, Insect, Monkey, Porcine, Sheep, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from an internal region of human FH |
Rabbit Polyclonal Anti-GABARAP
| Applications | WB |
| Reactivities | Human, Insect, Cow, Dog, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
Active filters
Reactivities
- Insect
Clonalities
- Polyclonal