Primary Antibodies

View as table Download

Goat Polyclonal Antibody against SERPINE1

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-GFKIDDKGMAPALRH, from the internal region of the protein sequence according to NP_000593.1.

Rabbit Polyclonal Serpin E1/PAI-1 Antibody

Applications ELISA, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human PAI1/Serpine 1 protein (between residues 300-400) [UniProt P05121]

PAI1 (SERPINE1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal SERPINE1 Antibody (Center)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SERPINE1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-216 amino acids from the Central region of human SERPINE1.

Rabbit Polyclonal Anti-SERPINE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINE1 antibody: synthetic peptide directed towards the C terminal of human SERPINE1. Synthetic peptide located within the following region: VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVM

Rabbit Polyclonal Anti-SERPINE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINE1 antibody: synthetic peptide directed towards the N terminal of human SERPINE1. Synthetic peptide located within the following region: VAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQ

PAI1 (SERPINE1) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant human PAI-1

PAI1 (SERPINE1) goat polyclonal antibody, Purified

Applications ELISA, IHC, R
Reactivities Human
Conjugation Unconjugated
Immunogen Purified human PAI-1

PAI1 (SERPINE1) goat polyclonal antibody, Purified

Applications ELISA, IHC, R
Reactivities Human
Conjugation Unconjugated
Immunogen Purified human PAI-1

PAI1 (SERPINE1) goat polyclonal antibody, Serum

Applications ELISA, IHC, R
Reactivities Human
Conjugation Unconjugated
Immunogen Purified Human PAI-1

PAI1 (SERPINE1) goat polyclonal antibody, Serum

Applications ELISA, IHC, R
Reactivities Human
Conjugation Unconjugated
Immunogen Purified Human PAI-1