Primary Antibodies

Jump to Filters
View as table Download
MTMR7 Rabbit Polyclonal Antibody
TA349576

USD 380.00

In Stock

Rabbit Polyclonal Anti-MTMR7 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MTMR7
TPK1 (N-term) Rabbit Polyclonal Antibody
AP54344PU-N

USD 580.00

2 Weeks

TPK1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of Human TPK1
MTMR7 Rabbit Polyclonal Antibody
TA332091

USD 539.00

5 Days

Rabbit Polyclonal Anti-MTMR7 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MTMR7 Antibody is: synthetic peptide directed towards the C-terminal region of Human MTMR7. Synthetic peptide located within the following region: NLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFL
PHPT1 Rabbit Polyclonal Antibody
TA326938

USD 365.00

3 Weeks

PHPT1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PHPT1