Primary Antibodies

View as table Download

Rabbit polyclonal DNA Polymerase lambda antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DNA Polymerase ?.

Goat Anti-POLL / BETA-N Antibody

Applications IHC
Reactivities Human (Expected from sequence similarity: Mouse)
Conjugation Unconjugated
Immunogen Peptide with sequence C-LGLPYREPAERDW, from the C Terminus of the protein sequence according to NP_037406.1.

Rabbit Polyclonal Anti-POLL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLL antibody is: synthetic peptide directed towards the middle region of Human POLL. Synthetic peptide located within the following region: DVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGV

Rabbit Polyclonal Anti-POLL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLL antibody: synthetic peptide directed towards the middle region of human POLL. Synthetic peptide located within the following region: SLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW