Rabbit Polyclonal Anti-DVL2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DVL2 |
Rabbit Polyclonal Anti-DVL2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DVL2 |
Rabbit Polyclonal Anti-DVL2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DVL2 antibody: synthetic peptide directed towards the N terminal of human DVL2. Synthetic peptide located within the following region: AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA |
Rabbit polyclonal anti-DVL2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human DVL2. |
Rabbit Polyclonal Anti-DVL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DVL2 antibody is: synthetic peptide directed towards the middle region of Human DVL2. Synthetic peptide located within the following region: HRTGGPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQ |