Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-STX7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human STX7

Rabbit Polyclonal Anti-STX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STX7 antibody: synthetic peptide directed towards the N terminal of human STX7. Synthetic peptide located within the following region: PSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVS