Primary Antibodies

View as table Download

Anti-BTG2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-BTG2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

BTG2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 40-69 amino acids from the N-terminal region of human BTG2

Rabbit anti-BTG2 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH

Rabbit Polyclonal Anti-BTG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-BTG2 Antibody: synthetic peptide directed towards the N terminal of human BTG2. Synthetic peptide located within the following region: MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHY

Rabbit Polyclonal Anti-BTG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-BTG2 Antibody: synthetic peptide directed towards the middle region of human BTG2. Synthetic peptide located within the following region: HKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICV