Rabbit Polyclonal Anti-PNN Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PNN |
Rabbit Polyclonal Anti-PNN Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PNN |
Rabbit polyclonal PNN Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Bovine) |
Conjugation | Unconjugated |
Immunogen | This PNN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 209-239 amino acids from the Central region of human PNN. |
Rabbit Polyclonal Anti-PNN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PNN antibody: synthetic peptide directed towards the N terminal of human PNN. Synthetic peptide located within the following region: MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP |
Rabbit polyclonal anti-PNN antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PNN. |
Rabbit Polyclonal Anti-PNN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PNN antibody: synthetic peptide directed towards the middle region of human PNN. Synthetic peptide located within the following region: RRSVDRKRRDTSGLERSHKSSKGGSSRDTKGSKDKNSRSDRKRSISESSR |