Germany
Japan
United Kingdom
China
Rabbit Polyclonal Ku80 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Primary Antibodies
View as table Download
Rabbit polyclonal antibody to Ku80 (XRCC5) (X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining))
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 315 and 593 of Ku80 (Uniprot ID#P13010) |
Rabbit polyclonal XRCC5 Antibody (Center K439)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This XRCC5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-450 amino acids from the Central region of human XRCC5. |
Rabbit polyclonal FEN1 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This FEN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 243-272 amino acids from the Central region of human FEN1. |
Rabbit anti-MRE11A Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MRE11A |
Rabbit polyclonal Anti-MRE11A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRE11A antibody: synthetic peptide directed towards the N terminal of human MRE11A. Synthetic peptide located within the following region: DTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLRKYCM |
Goat Polyclonal Antibody against XRCC5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SLAKKDEKTDTLED, from the internal region of the protein sequence according to NP_066964.1. |
Rabbit polyclonal anti-Mre11 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corres-ponding to amino acids 68-706 of mouse Mre11 protein. |
Active filters
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Stem cell - Pluripotency
Pathways
- Non-homologous end-joining