Rabbit Polyclonal Anti-MTMR7 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MTMR7 |
Rabbit Polyclonal Anti-MTMR7 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MTMR7 |
Anti-ACPP Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 3-389 amino acids of human acid phosphatase, prostate |
Anti-ACPP Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 3-389 amino acids of human acid phosphatase, prostate |
Rabbit Polyclonal Anti-MTMR7 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MTMR7 Antibody is: synthetic peptide directed towards the C-terminal region of Human MTMR7. Synthetic peptide located within the following region: NLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFL |
Rabbit polyclonal antibody to ACPP (acid phosphatase, prostate)
Applications | WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 177 and 362 of Prostatic Acid Phosphatase |
Goat Anti-ACPP Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-YGIHKQKEKSRLQ, from the internal region of the protein sequence according to NP_001090.2. |