Rabbit Polyclonal c-Myc Antibody
| Applications | ChIP, ELISA, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106] |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Dog, Feline, Pig, Sheep, Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit polyclonal FGF4 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-198 amino acids from the C-terminal region of human FGF4. |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Germany
Japan
United Kingdom
China
