Primary Antibodies

View as table Download

Anti-BAG3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 200 amino acids of human BCL2-associated athanogene 3
TA322773 is a possible alternative to TA322772.

Rabbit polyclonal anti-BAG3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BAG3.

Rabbit Polyclonal BAG3 Antibody

Applications ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A recombinant protein fragment corresponding to the C-terminal 196 amino acids of human BAG-3. Bag-3; full length-gel=GST-RP; human

Anti-BAG3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 200 amino acids of human BCL2-associated athanogene 3

Goat Anti-BAG3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KNAGNAEDPHTE, from the internal region of the protein sequence according to NP_004272.2.

Goat Anti-BAG3 / BIS/ CAIR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SSMTDTPGNPAAP, from the C Terminus of the protein sequence according to NP_004272.2.

Rabbit Polyclonal Anti-BAG3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BAG3 antibody: synthetic peptide directed towards the middle region of human BAG3. Synthetic peptide located within the following region: NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS