Primary Antibodies

View as table Download

Anti-DFFB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 146-160 amino acids of human DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase)

Rabbit Polyclonal Anti-DFFB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DFFB antibody: synthetic peptide directed towards the middle region of human DFFB. Synthetic peptide located within the following region: EYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRK