Rabbit Polyclonal Anti-ADH6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADH6 antibody: synthetic peptide directed towards the middle region of human ADH6. Synthetic peptide located within the following region: AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID |
Rabbit Polyclonal Anti-ARD1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARD1A antibody: synthetic peptide directed towards the middle region of human ARD1A. Synthetic peptide located within the following region: VESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSE |
Rabbit Polyclonal Anti-LCMT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LCMT2 antibody: synthetic peptide directed towards the C terminal of human LCMT2. Synthetic peptide located within the following region: PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS |
Rabbit Polyclonal Anti-METTL2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-METTL2B antibody: synthetic peptide directed towards the N terminal of human METTL2B. Synthetic peptide located within the following region: AGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAE |
Rabbit Polyclonal Anti-METTL2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-METTL2B antibody: synthetic peptide directed towards the N terminal of human METTL2B. Synthetic peptide located within the following region: INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS |
Rabbit polyclonal Tyrosine Hydroxylase (Ser31) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of serine 31 (V-T-SP-P-R). |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China