Primary Antibodies

View as table Download

Rabbit Polyclonal Antibody against ATG5

Applications Electron Microscopy, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB
Reactivities Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0]

Rabbit polyclonal ATG5 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Bovine, Pig)
Conjugation Unconjugated
Immunogen This ATG5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human ATG5.

Rabbit Polyclonal Anti-ATG5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATG5 Antibody: synthetic peptide directed towards the C terminal of human ATG5. Synthetic peptide located within the following region: DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD

Rabbit polyclonal APG5 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ATG5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the full length of human ATG5.

Rabbit Polyclonal ATG5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG5 antibody was raised against a 16 amino acid peptide from near the amino terminus of human ATG5.

Chicken Polyclonal ATG5 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG5 antibody was raised against a 16 amino acid peptide from near the amino terminus of human ATG5.

ATG5 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ATG5